ESM — Protein Language Models
Overview
ESM (Evolutionary Scale Modeling) provides pretrained protein language models for generative protein design and representation learning. ESM3 is a multimodal generative model conditioned on sequence, structure, and function simultaneously. ESM C is an efficient embedding model optimized for extracting protein representations for downstream ML tasks.
When to Use
- Generating novel protein sequences conditioned on desired structure or function
- Extracting fixed-length embeddings from protein sequences for classification, clustering, or regression
- Predicting 3D structure from amino acid sequence
- Inverse folding: designing sequences that fold into a target structure
- Annotating proteins with functional keywords (GO terms, EC numbers)
- Comparing protein similarity via embedding distance instead of sequence alignment
- Chain-of-thought protein design: iterative refinement of sequence/structure/function
- For traditional physics-based structure prediction, use AlphaFold instead
- For sequence alignment and homology search, use BLAST/HMMER via BioPython instead
Prerequisites
- Python packages:
esm(EvolutionaryScale package) - Hardware: GPU recommended for local inference (ESM3: 8GB+ VRAM; ESM C: 4GB+ VRAM). CPU works for small batches
- Cloud alternative: EvolutionaryScale Forge API (requires API token from forge.evolutionaryscale.ai)
- Model weights: Downloaded automatically on first use (~1-4 GB depending on model)
pip install esm
# For Forge cloud API
pip install esm[forge]
Quick Start
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
# Load ESM C model for embeddings
model = ESMC.from_pretrained("esmc_600m")
# Create protein from sequence
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN")
# Get per-residue embeddings
output = model(protein)
embeddings = output.embeddings # shape: (1, seq_len, embedding_dim)
print(f"Embedding shape: {embeddings.shape}")
# Embedding shape: (1, 101, 1152)
Core API
1. Protein Sequence Generation (ESM3)
Generate novel protein sequences conditioned on structure, function, or partial sequence.
from esm.models.esm3 import ESM3
from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig
# Load ESM3 locally
model = ESM3.from_pretrained("esm3_sm_open_v1")
# Generate from partial sequence (fill in masked positions)
prompt = ESMProtein(sequence="MKTAYIAK____ISFVK____RQLEERLG") # ____ = positions to generate
config = GenerationConfig(track="sequence", num_steps=10, temperature=0.7)
generated = model.generate(prompt, config)
print(f"Generated sequence: {generated.sequence[:50]}...")
# Conditional generation: design sequence for a target structure
from esm.sdk.api import ESMProtein, GenerationConfig
from esm.utils.structure.protein_chain import ProteinChain
# Load target structure from PDB
chain = ProteinChain.from_pdb("target.pdb")
prompt = ESMProtein.from_protein_chain(chain)
prompt.sequence = None # Clear sequence, keep structure
config = GenerationConfig(track="sequence", num_steps=16, temperature=0.5)
designed = model.generate(prompt, config)
print(f"Designed sequence ({len(designed.sequence)} residues): {designed.sequence[:50]}...")
2. Protein Embeddings (ESM C)
Extract fixed-length representations for downstream ML tasks.
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
model = ESMC.from_pretrained("esmc_600m") # or "esmc_300m" for lighter model
sequences = [
"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN",
"MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS",
]
embeddings = []
for seq in sequences:
protein = ESMProtein(sequence=seq)
output = model(protein)
# Mean-pool per-residue embeddings to get fixed-length vector
mean_emb = output.embeddings.mean(dim=1) # shape: (1, embedding_dim)
embeddings.append(mean_emb)
emb_matrix = torch.cat(embeddings, dim=0)
print(f"Embedding matrix: {emb_matrix.shape}") # (2, 1152)
# Compute pairwise similarity
similarity = torch.cosine_similarity(emb_matrix[0:1], emb_matrix[1:2])
print(f"Cosine similarity: {similarity.item():.4f}")
3. Structure Prediction
Predict 3D coordinates from amino acid sequence.
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
model = ESM3.from_pretrained("esm3_sm_open_v1")
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN")
# Generate structure from sequence
config = GenerationConfig(track="structure", num_steps=16)
result = model.generate(protein, config)
# Save predicted structure
result.to_pdb("predicted.pdb")
print(f"Saved structure: {len(result.sequence)} residues → predicted.pdb")
4. Inverse Folding
Design amino acid sequences that fold into a target 3D structure.
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
from esm.utils.structure.protein_chain import ProteinChain
model = ESM3.from_pretrained("esm3_sm_open_v1")
# Load target structure
chain = ProteinChain.from_pdb("target_structure.pdb")
prompt = ESMProtein.from_protein_chain(chain)
# Clear sequence but keep structure coordinates
prompt.sequence = None
# Generate multiple designs
designs = []
for i in range(5):
config = GenerationConfig(track="sequence", num_steps=16, temperature=0.7)
designed = model.generate(prompt, config)
designs.append(designed.sequence)
print(f"Design {i+1}: {designed.sequence[:40]}...")
print(f"Generated {len(designs)} sequence designs for target structure")
5. Function Conditioning
Generate proteins with desired functional annotations (GO terms, enzyme activity).
from esm.models.esm3 import ESM3
from esm.sdk.api import ESMProtein, GenerationConfig
model = ESM3.from_pretrained("esm3_sm_open_v1")
# Condition on functional keywords
protein = ESMProtein(
sequence=None, # generate de novo
function_annotations=["ATP binding", "kinase activity", "protein phosphorylation"],
)
config = GenerationConfig(track="sequence", num_steps=32, temperature=0.7)
result = model.generate(protein, config)
print(f"Function-conditioned sequence: {result.sequence[:50]}...")
print(f"Length: {len(result.sequence)} residues")
6. Forge Cloud API
Use EvolutionaryScale's cloud inference for large models without local GPU.
from esm.sdk.forge import ESM3ForgeInferenceClient
from esm.sdk.api import ESMProtein, GenerationConfig
# Authenticate (requires FORGE_API_TOKEN env var or explicit token)
client = ESM3ForgeInferenceClient(model="esm3-open-2024-03", token="your_token_here")
protein = ESMProtein(sequence="MKTAYIAKQRQISFVKSHFSRQLEERLG")
config = GenerationConfig(track="structure", num_steps=16)
result = client.generate(protein, config)
result.to_pdb("forge_predicted.pdb")
print("Predicted structure via Forge API → forge_predicted.pdb")
Key Concepts
ESM3 vs ESM C: When to Use Which
| Feature | ESM3 | ESM C | |---------|------|-------| | Primary use | Generative protein design | Embedding extraction | | Capabilities | Sequence generation, structure prediction, inverse folding, function conditioning | Per-residue and mean-pooled embeddings | | Model sizes | esm3_sm_open_v1 (~1.4B params) | esmc_300m, esmc_600m | | GPU requirement | 8GB+ VRAM | 4GB+ VRAM (esmc_300m: 2GB) | | Use case | Design new proteins, predict structures | Downstream ML (classification, clustering, regression) | | Cloud option | Forge API (larger models available) | Local only |
GenerationConfig Parameters
The GenerationConfig controls how ESM3 generates outputs:
track: Which modality to generate ("sequence","structure","function")num_steps: Number of iterative refinement steps (higher = better quality, slower)temperature: Sampling temperature (0.0 = greedy, 0.5-0.7 = diverse, 1.0 = maximum diversity)
ESMProtein Object
The central data container holding sequence, structure coordinates, and functional annotations:
.sequence— amino acid string (e.g., "MKTAY...").coordinates— 3D atom positions (Nx3 tensor).function_annotations— list of functional keywords- Use
ESMProtein.from_protein_chain()to load from PDB structures - Use
.to_pdb()to save predicted structures
Common Workflows
Workflow 1: Protein Embedding-Based Classification
Goal: Extract embeddings from protein sequences and train a downstream classifier.
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np
model = ESMC.from_pretrained("esmc_600m")
# Embed a set of sequences
sequences = ["MKTAY...", "MKWVT...", "MSGLI..."] # replace with actual sequences
labels = [0, 1, 0] # binary labels
embeddings = []
for seq in sequences:
protein = ESMProtein(sequence=seq)
output = model(protein)
mean_emb = output.embeddings.mean(dim=1).detach().cpu().numpy()
embeddings.append(mean_emb.squeeze())
X = np.array(embeddings)
y = np.array(labels)
print(f"Feature matrix: {X.shape}") # (n_samples, 1152)
# Train a simple classifier
from sklearn.linear_model import LogisticRegression
clf = LogisticRegression(max_iter=1000).fit(X, y)
print(f"Training accuracy: {clf.score(X, y):.2f}")
Workflow 2: Structure-Conditioned Protein Design
Goal: Design multiple novel sequences that fold into a target structure, then rank by predicted quality.
- Load target structure from PDB using
ProteinChain.from_pdb()(Core API module 4) - Create ESMProtein prompt with structure but no sequence
- Generate 10+ sequence designs with
temperature=0.7for diversity (Core API module 1) - For each design, predict structure from designed sequence (Core API module 3)
- Compare predicted structure to target structure (RMSD calculation) to rank designs
- Select top designs for experimental validation
Key Parameters
| Parameter | Module/Function | Default | Range / Options | Effect |
|-----------|----------------|---------|-----------------|--------|
| num_steps | GenerationConfig | varies | 1–64 | Iterative refinement steps; more = higher quality, slower |
| temperature | GenerationConfig | 1.0 | 0.0–1.5 | Sampling diversity; 0.0=greedy, 0.7=balanced, 1.0+=creative |
| track | GenerationConfig | — | "sequence", "structure", "function" | Which modality to generate |
| model name | from_pretrained | — | "esm3_sm_open_v1", "esmc_300m", "esmc_600m" | Model size/capability tradeoff |
| token | ESM3ForgeInferenceClient | env var | API token string | Forge cloud authentication |
Best Practices
-
Use ESM C for embedding tasks, ESM3 for generation: ESM C is smaller, faster, and optimized for representation quality. Only use ESM3 when you need generative capabilities (sequence design, structure prediction, inverse folding).
-
Mean-pool per-residue embeddings for fixed-length representations: ESM C outputs per-residue embeddings (seq_len × dim). For downstream ML that requires fixed-length input, average across the sequence dimension:
embeddings.mean(dim=1). -
Use temperature 0.5–0.7 for protein design: Temperature 1.0 produces very diverse but potentially non-functional sequences. Temperature 0.5–0.7 balances diversity with quality. Use temperature 0.0 only for deterministic structure prediction.
-
Increase num_steps for higher-quality generation: More iterative refinement steps improve output quality at the cost of computation time. Use 8–16 steps for quick exploration, 32+ for final designs.
-
Batch sequences to maximize GPU utilization: Processing one sequence at a time underutilizes the GPU. When embedding many sequences, batch them (limited by VRAM).
-
Use Forge API for large-scale or large-model inference: The open-weight ESM3 is a smaller variant. For production-quality protein design, the Forge API provides access to larger models.
Common Recipes
Recipe: Pairwise Protein Similarity Matrix
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np
model = ESMC.from_pretrained("esmc_300m")
sequences = {
"Protein_A": "MKTAYIAKQRQISFVK...",
"Protein_B": "MKWVTFISLLFLFSSAYS...",
"Protein_C": "MSGLILQRAAVIAAGASSAG...",
}
# Extract embeddings
embs = {}
for name, seq in sequences.items():
protein = ESMProtein(sequence=seq)
output = model(protein)
embs[name] = output.embeddings.mean(dim=1).detach().squeeze()
# Compute similarity matrix
names = list(embs.keys())
sim_matrix = np.zeros((len(names), len(names)))
for i, n1 in enumerate(names):
for j, n2 in enumerate(names):
sim_matrix[i, j] = torch.cosine_similarity(embs[n1].unsqueeze(0), embs[n2].unsqueeze(0)).item()
print("Similarity matrix:")
for i, name in enumerate(names):
print(f" {name}: {sim_matrix[i].round(3)}")
Recipe: Save/Load Embeddings for Reuse
from esm.models.esmc import ESMC
from esm.sdk.api import ESMProtein
import torch
import numpy as np
model = ESMC.from_pretrained("esmc_600m")
# Generate and save
protein = ESMProtein(sequence="MKTAYIAKQRQISFVK...")
output = model(protein)
np.save("embedding.npy", output.embeddings.detach().cpu().numpy())
print("Saved embedding.npy")
# Load later (no GPU needed)
embedding = np.load("embedding.npy")
print(f"Loaded embedding: {embedding.shape}")
Troubleshooting
| Problem | Cause | Solution |
|---------|-------|----------|
| CUDA out of memory | Model too large for GPU | Use smaller model (esmc_300m), reduce batch size, or use Forge cloud API |
| RuntimeError: no CUDA device | No GPU available | Models work on CPU (slower). Set device="cpu" or use Forge API |
| Slow generation | Too many num_steps or CPU inference | Reduce num_steps (8 for drafts), use GPU, or use Forge API for large models |
| ImportError: esm | Package not installed | pip install esm (note: this is EvolutionaryScale's esm, not the older Facebook Research esm) |
| Low-quality generated sequences | Temperature too high or too few steps | Lower temperature to 0.5, increase num_steps to 32+ |
| Forge API authentication error | Invalid or missing API token | Set FORGE_API_TOKEN env var or pass token= explicitly; get token from forge.evolutionaryscale.ai |
| KeyError loading model weights | Wrong model name | Use exact names: "esm3_sm_open_v1", "esmc_300m", "esmc_600m" |
Related Skills
- alphafold-database-access — retrieve predicted structures from AlphaFold DB; use ESM for de novo structure prediction
- biopython — sequence I/O and alignment; preprocess sequences before ESM embedding
- scikit-learn — downstream ML on ESM embeddings (classification, clustering, regression)
- rdkit — cheminformatics for small-molecule drug design (complementary to protein design)
References
- ESM GitHub — source code and model weights
- EvolutionaryScale Forge — cloud inference API
- Hayes et al. (2024) "Simulating 500 million years of evolution with a language model" — bioRxiv
- Lin et al. (2023) "Evolutionary-scale prediction of atomic-level protein structure with a language model" — Science
Scan to join WeChat group